PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC051544.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MIKC_MADS
Protein Properties Length: 209aa    MW: 24005.4 Da    PI: 10.3141
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC051544.30genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.34.9e-291059251
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  rien + rqvtfskRrng+lKKA+ELSvLCdaeva iifs++g+lye+ss
  EcC051544.30 10 RIENVTSRQVTFSKRRNGLLKKAYELSVLCDAEVAAIIFSQKGRLYEFSS 59
                  8***********************************************96 PP

2K-box61.53.3e-21841711097
         K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                    e+   +l++e   ++++ie L+ ++ +l G++L+s+s+ e+q + +qLe+sl++iR++K +l+ +q ++lq ke++l+een +L +k
  EcC051544.30  84 MEQRILHLKRETMEMERKIELLEVSLQKLSGQCLGSCSIDEIQGIGDQLERSLSSIRKRKVQLFNDQRQQLQAKERSLREENAKLLAK 171
                   566777999****************************************************************************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.861161IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-39160IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-30323IPR002100Transcription factor, MADS-box
CDDcd002657.14E-39376No hitNo description
SuperFamilySSF554554.84E-31375IPR002100Transcription factor, MADS-box
PfamPF003194.7E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-303859IPR002100Transcription factor, MADS-box
PfamPF014865.2E-1986172IPR002487Transcription factor, K-box
PROSITE profilePS5129713.08688178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MVRGKIQMRR IENVTSRQVT FSKRRNGLLK KAYELSVLCD AEVAAIIFSQ KGRLYEFSSN  60
SEIRKTIDRY RGSTNDVDTY RANMEQRILH LKRETMEMER KIELLEVSLQ KLSGQCLGSC  120
SIDEIQGIGD QLERSLSSIR KRKVQLFNDQ RQQLQAKERS LREENAKLLA KCLANHGQST  180
ANPRATALHR RSSWSTDVET GLFIGLPES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S7e-17159159Myocyte-specific enhancer factor 2B
1tqe_R7e-17159159Myocyte-specific enhancer factor 2B
1tqe_Q7e-17159159Myocyte-specific enhancer factor 2B
1tqe_P7e-17159159Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010035074.11e-150PREDICTED: MADS-box protein SOC1-like
SwissprotQ9FIS12e-70AGL42_ARATH; MADS-box protein AGL42
TrEMBLA0A058ZZ531e-150A0A058ZZ53_EUCGR; Uncharacterized protein
STRINGGLYMA18G45780.15e-72(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.31e-71AGAMOUS-like 42